PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr042313.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 307aa    MW: 34533.7 Da    PI: 9.8605
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr042313.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-072871344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     rWT+ E + + +a + + ++   +W+++a+ ++ g+t  ++   +
      Pbr042313.1 28 RWTPAENKMFENALAVYDKDapdRWHKVAELIP-GKTVRDVMKQY 71
                     9********************************.***99998766 PP

2Myb_DNA-binding48.22.5e-15137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
      Pbr042313.1 137 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 181
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-42373IPR009057Homeodomain-like
PROSITE profilePS512938.4892479IPR017884SANT domain
SMARTSM007171.1E-72577IPR001005SANT/Myb domain
SuperFamilySSF466892.69E-102574IPR009057Homeodomain-like
CDDcd001672.39E-72874No hitNo description
PfamPF002499.3E-62871IPR001005SANT/Myb domain
PROSITE profilePS5129421.817130186IPR017930Myb domain
SuperFamilySSF466897.03E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-18133185IPR006447Myb domain, plants
SMARTSM007172.7E-13134184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-13134181IPR009057Homeodomain-like
CDDcd001671.35E-11137182No hitNo description
PfamPF002495.4E-13137181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MKFEMEILSP SSYFATSNRL IEESKSARWT PAENKMFENA LAVYDKDAPD RWHKVAELIP  60
GKTVRDVMKQ YEELELDVGK IEAGLIPIPG YGPSPFTLEW VNRHGSYDGF KQQSYGIGGK  120
RSSSNRPSDH ERKKGVPWTE EEHKLFLMGL KKYGKGDWRN ISRNFVVTRT PTQVASHAQK  180
YFIRQLSGGK DKRRASIHDI TVNLNDMRTP SPDNKSPLSP ELPQHPNSAA TARAPFQWHQ  240
PQGGGVNLGF NQGHGNMFMS SHPYGISSYG QKMQGQDLHK GAANNLYYGP QNLGFQMQSS  300
QHYPHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1629911173RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374277.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-134DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5VZC70.0M5VZC7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g06100.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-99Homeodomain-like transcriptional regulator